IGF-1 LR3
For research use only.

For laboratory research use only. Not for human or veterinary consumption, diagnostic, or therapeutic use.
- Compound
- IGF-1 LR3
- CAS
- 946870-92-4
- Formula
- C400H625N111O115S9
- Molecular weight
- 9117.6 g/mol
- Sizes
- 10 mg
- Storage
- Temperature: Store at –20°C for long-term stability Protect From: Light, humidity, and repeated freeze-thaw cycles
IGF-1 LR3. White or off-white lyophilized powder. Molecular formula C400H625N111O115S9. Molecular weight 9117.6 g/mol. CAS 946870-92-4. Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA. Supplied for laboratory research use only. Not for human or veterinary use.
Every released lot.
Pick a size, then the batch, and read the figures the laboratory reported for that exact run. Draft and withdrawn lots are not listed.
✓ Passed full QC panel
- Variant
- IGF-1 LR3
- Lot #
- TP-IGF-01-01
- Labeled
- 1 mg
- Actual
- 0.97 mg
- Tested
- 2026-08-26
Full QC panel — 8x× tested
- Purity (HPLC)99.48%
- Net Peptide Content0.97 mg
- Identity (LC-MS)Confirmed
- HPLC Conformity99.48%
- ConformityConforms
- Heavy Metals (ICP-MS)Not Detected
- Sterility (PCR)No Growth
- EndotoxinReported
- Fentanyl ScreenNot Detected
Research use only · For laboratory research use only. Not for human or veterinary consumption, diagnostic, or therapeutic use.

